Wholesale Marketplace
Home >

Muscle Growth Hormone

Refine Search

Business Type

Region

muscle growth hormone

All muscle growth hormone wholesalers & muscle growth hormone manufacturers come from members. We doesn't provide muscle growth hormone products or service, please contact them directly and verify their companies info carefully.

Total 14004 products from muscle growth hormone Manufactures & Suppliers
Best USP Standard Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 wholesale

Brand Name:Mking

Model Number:CAS 53-39-4

Place of Origin:Hubei, China

...Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 USP Standard Oxandrolone / Anavar Quick Info Product Name: Oxandrolone CAS: ...

Hubei Mking Biotech Co., Ltd.
Verified Supplier

Hubei

Best Muscle Growth Hormone Gensic HGH hygetropin 200iu jintropin for bodybuilding wholesale

Brand Name:Hong Kong Blue

Model Number:HGH hygeteropin

Place of Origin:China

...Legit Human Growth Hormone Gensic HGH hygetrpin 200iu for bodybuilding Guarantee safe shipping Hygetropin 200iu 25iu/vial, 10vials/kit ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Best Human Growth Hormone Peptide IGF-1 LR3 1mg , Natural Muscle Growth Hormone Peptide wholesale

Brand Name:Pharmlab

Model Number:IGF-1 LR3

Place of Origin:China

...Human Growth Hormone Peptide IGF-1 LR3 1mg For Natural Muscle Growth Quick detial Product name: IGF-1Lr3 Appearance:White lyophilized powder Specification: 1mg/vial Packing:10vials per kits Catagory: Human Growth Hormone Peptide There was a variety...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Best Medicine Grade Muscle Growth Hormone , Hygetropin Growth Hormone For Adults wholesale

Brand Name:HY

Model Number:Hygetropin

Place of Origin:CHINA

...Hygetropin Human Growth Hormone Steroid Muscle Building White Lyophilized Powder ygetropin is offered in two dosages / sizes Somatropin rDNA origin 10iu ( 3....

Hongyu Chemical Co.,Ltd.
Verified Supplier

Hubei

Best Muscle Growth Hormone withe raw powder Oral Oxandrolone / Anavar CAS NO.53-39-4 wholesale

Brand Name:DW

Model Number:CAS NO:53-39-4

Place of Origin:China

...Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 USP Standard Oxandrolone / Anavar Quick Info Product Name: Oxandrolone CAS: ...

Doublewin Biological Technology Co., Ltd.
Verified Supplier

Guangxi

Best Mass Body Building Muscle Growth Hormone Hgh Supplement Hygetropin 8iu / Vial wholesale

Brand Name:dingsheng

Model Number:hygetropin

Place of Origin:China

...Skype:jhonrcbest Pharmaceutical Mass Body Building Growth Hormone Peptides Hgh Hygetropin 8iu / Vial 10iu / Vial product detail Product name: hygetropin Assay: 99.8% Packaging ...

Linyi dingsheng chemical products Co., Ltd
Verified Supplier

Shandong

Best Melanotan 2 Lean Muscle Growth Hormone Peptides Muscle Building Melanotan II wholesale

Brand Name:Shanghai Stero

Model Number:121062-08-6

Place of Origin:China

...Melanotan 2 Lean Muscle Growth Hormone Peptides Muscle Building Melanotan II Description: Melanotan 2 is a synthetically created peptide that stimulates skin tanning, increased libido, ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Best GHRP-6 Growth Hormone Releasing Peptide , Muscle Growth Hormone CAS 87616-84-0 wholesale

Brand Name:LSW

Model Number:87616-84-0

Place of Origin:China

...Fat Burning Human Growth Hormone Peptide Releasing GHRP-6 for Lean Muscle Mass 99.5% Purity CAS 87616-84-0 Description GHRP-6 is an injectable peptide in the category of growth hormone releasing peptides, or GHRP’s.,GHRP-6 is...

Wuhan Lianshangwang Technology Co.,Ltd
Verified Supplier

Hubei

Best Hgh Fragment 176-191 (2mg/vial) Muscle Growth Hormone Peptides Lyophilized Powder For Bodybuilding Supplements wholesale

Brand Name:LSW

Model Number:Hgh Fragment 176-191

Place of Origin:China

...Muscle Growth Hormone Peptides Hgh Fragment 176-191 (2mg/vial) For Bodybuilding Supplements Notes: Hgh Fragment 176-191≠ ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Best White Muscle Growth Hormones Anabolic Steroid Powder 1- Testosterone Cypionate / 1 - Tc / Dihydrobolden Cypionate wholesale

Brand Name:HW Testosterone Steroid

Model Number:Pharmaceutical Grade Testosterone Steroid

Place of Origin:China

...Muscle Growth Hormones Anabolic Steroid Powder 1- Testosterone Cypionate / 1 - Tc / Dihydrobolden Cypionate Testosterone Steroid Product Details Product Name: Dihydrobolden ...

Shenzhen Haiwen Bio-Technology Co.,Ltd
Verified Supplier

Guangdong

Best Anabolic Sex Muscle Growth Hormones Without Side Effects Tadalafil 171596-29-5 wholesale

Brand Name:NJBN STERIOD

Model Number:171596-29-5

Place of Origin:Made-in-China

...Anabolic Sex Muscle Growth Hormones Without Side Effects Tadalafil 171596-29-5 Basic information Name Tadalafil Appearence White crystalline powder Cas ...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Best Muscle Growth Hormone Peptides Ipamorelin for Bodybuilding CAS 170851-70-4 wholesale

Brand Name:JNJG

Model Number:170851-70-4

Place of Origin:CHINA

...Muscle Growth Hormone Peptides Ipamorelin for Bodybuilding CAS 170851-70-4 Ipamorelin Details: Product Name Ipamorelin Ipamorelin Alias NNC ...

Jinan  Jiage  Biological Technology Co.,Ltd
Verified Supplier

Shandong

Best Muscle Growth Hormone Peptides Bodybuilding 1mg / Vial Follistatin 315 Fst -315 white powder wholesale

Brand Name:JNJG

Model Number:30729649

Place of Origin:CHINA

...Muscle Growth Hormone Peptides Bodybuilding 1mg / Vial Follistatin 315 Fst -315 Follistatin 315 Quick Detail: Product Name: Follistatin ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Best Boldenone Cypionate Muscle Growth Hormone Raw Steroid Powder 106505-90-2 wholesale

Brand Name:Bio Friend(BOF)

Model Number:106505-90-2

Place of Origin:China Wuhan

...Boldenone Cypionate Muscle Growth Hormone Raw Steroid Powder 106505-90-2 COA: Product name Boldenone Cypionate Water Content 0.5%max 0.28% Specific ...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Best Muscle Growth Hormones Pure Testosterone Steroid for Testosterone Cypionate Cycle CAS 58-20-8 wholesale

Model Number:58-20-8

... dosage and good results for testosterone cypionate cycle Testosterone is a hormone produced by all human beings and is the primary male sex hormone. Through our discussion, well take a look at Testosterone Cypionate...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hongkong

Best Muscle Growth Hormone Powder Testosterone Undecanoate for Hypogonadism Treatment wholesale

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

... be used as pharmaceutical material. Its main function is to promote metabolism. Anabolic effects include growth of muscle mass and strength, increased bone density and strength, and stimulation of linear

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Best Raw Muscle Growth Hormone Powder Turinabol Clostebol Acetate CAS855-19-6 wholesale

Brand Name:Yuancheng

Model Number:855-19-6

Place of Origin:Wuhan,Hubei

...Raw Muscle Growth Hormone Powder Turinabol Clostebol Acetate CAS855-19-6 Alias: Megagrisevit; Clostebol acetate CAS No: 855-19-6 Einecs ...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Best Lyophilized Peptides Powder Hexarelin ( Hexarelin Acetate ) for Muscle Growth Hormones wholesale

Brand Name:wumeitech

Model Number:Hexarelin Acetate

Place of Origin:China

...Lyophilized Peptides Powder Hexarelin (Hexarelin Acetate) for Muscle Growth Alias: HEX, Hexarelin Acetate, Examorelin Hexarelin CAS: 140703-51-1 Hexarelin Sequence: His-D-2-methyl-Trp-Ala-...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Best IGF DES 1mg / vial HGH Anabolic Steroids Muscle Growth Hormone Peptides Protection wholesale

Brand Name:GB

Model Number:1mg/vial 10vials/box

Place of Origin:China

...IGF-1DES 1mg / vial Muscle Growth Hormone Peptides Protection 1. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 2. Molar Mass: 7,372 Da 3. Synonyms: IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3) 4. Compound: ...

Hubei God bull Pharmaceutical Co.,Ltd
Verified Supplier

Hubei

Best Testosterone Decanoate Muscle Growth Hormone Nutrition Supplements Neotest 250 wholesale

Brand Name:email: lisa@pharmade.com

Model Number:15262-86-9

Place of Origin:China

...Testosterone Decanoate Muscle Growth Hormone Nutrition Supplements Neotest 250 Description: Testosterone Decanoate: Anabolic Hormones; Anabolin; Anabolic Steroids; Steroid Powder; Hormone Powders; Bodybuilding; Raw Powder; Muscle Building; Raw Testosterone...

Shenzhen Shijingu Technology Co., Ltd.
Verified Supplier

Guangdong

Go to Page
Inquiry Cart 0